Description
LL-37 is the only cathelicidin-family antimicrobial peptide found in humans, a 37-amino-acid linear peptide cleaved from the precursor protein hCAP18. Sequence: [LL-37, 37 aa] Molecular formula: C205H340N60O53; molecular weight: 4493.3 g/mol.
Research on LL-37 has examined its antimicrobial membrane-disruption activity against bacterial pathogens, immunomodulatory signaling through formyl peptide receptors and other cell-surface receptors, and wound-healing-related cell migration in vitro and in animal models.
Supplied as a lyophilized powder for reconstitution, each batch is analyzed by HPLC to confirm purity and identity.
For laboratory research use only. Not for human or veterinary use, and not intended for diagnostic or therapeutic application.
